Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5174226..5174851 | Replicon | chromosome |
Accession | NZ_LR890291 | ||
Organism | Klebsiella pneumoniae strain KSB1_1B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JMW65_RS25255 | Protein ID | WP_094645114.1 |
Coordinates | 5174226..5174609 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMW65_RS25260 | Protein ID | WP_004150355.1 |
Coordinates | 5174609..5174851 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW65_RS25240 | 5171592..5172494 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMW65_RS25245 | 5172491..5173126 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMW65_RS25250 | 5173123..5174052 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMW65_RS25255 | 5174226..5174609 | - | 384 | WP_094645114.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW65_RS25260 | 5174609..5174851 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMW65_RS25265 | 5175056..5175973 | + | 918 | WP_088497967.1 | alpha/beta hydrolase | - |
JMW65_RS25270 | 5175987..5176928 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMW65_RS25275 | 5176973..5177410 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW65_RS25280 | 5177407..5178267 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
JMW65_RS25285 | 5178261..5178860 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14324.57 Da Isoelectric Point: 6.7186
>T290543 WP_094645114.1 NZ_LR890291:c5174609-5174226 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGCREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGCREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|