Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4696380..4696896 | Replicon | chromosome |
Accession | NZ_LR890291 | ||
Organism | Klebsiella pneumoniae strain KSB1_1B |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMW65_RS22975 | Protein ID | WP_094645165.1 |
Coordinates | 4696380..4696664 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMW65_RS22980 | Protein ID | WP_002886901.1 |
Coordinates | 4696654..4696896 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW65_RS22950 | 4691776..4692084 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
JMW65_RS22955 | 4692169..4692342 | + | 174 | WP_032408826.1 | hypothetical protein | - |
JMW65_RS22960 | 4692345..4693088 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMW65_RS22965 | 4693445..4695583 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMW65_RS22970 | 4695912..4696376 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMW65_RS22975 | 4696380..4696664 | - | 285 | WP_094645165.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW65_RS22980 | 4696654..4696896 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMW65_RS22985 | 4696974..4698884 | - | 1911 | WP_009486549.1 | BglG family transcription antiterminator | - |
JMW65_RS22990 | 4698907..4700061 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
JMW65_RS22995 | 4700128..4700868 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11069.93 Da Isoelectric Point: 10.4962
>T290541 WP_094645165.1 NZ_LR890291:c4696664-4696380 [Klebsiella pneumoniae]
MTYELEFDPRAWRGWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWRGWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|