Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3976410..3977029 | Replicon | chromosome |
| Accession | NZ_LR890291 | ||
| Organism | Klebsiella pneumoniae strain KSB1_1B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | JMW65_RS19555 | Protein ID | WP_002892050.1 |
| Coordinates | 3976811..3977029 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | JMW65_RS19550 | Protein ID | WP_002892066.1 |
| Coordinates | 3976410..3976784 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW65_RS19540 | 3971562..3972755 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMW65_RS19545 | 3972778..3975924 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| JMW65_RS19550 | 3976410..3976784 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| JMW65_RS19555 | 3976811..3977029 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| JMW65_RS19560 | 3977188..3977754 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| JMW65_RS19565 | 3977726..3977866 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| JMW65_RS19570 | 3977887..3978357 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| JMW65_RS19575 | 3978332..3979783 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| JMW65_RS19580 | 3979884..3980582 | + | 699 | WP_002892021.1 | GNAT family N-acetyltransferase | - |
| JMW65_RS19585 | 3980579..3980719 | - | 141 | WP_040245625.1 | type B 50S ribosomal protein L36 | - |
| JMW65_RS19590 | 3980719..3980982 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290539 WP_002892050.1 NZ_LR890291:3976811-3977029 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT290539 WP_002892066.1 NZ_LR890291:3976410-3976784 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |