Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1203534..1204201 | Replicon | chromosome |
| Accession | NZ_LR890291 | ||
| Organism | Klebsiella pneumoniae strain KSB1_1B | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A6N8NBW6 |
| Locus tag | JMW65_RS05995 | Protein ID | WP_000854675.1 |
| Coordinates | 1203534..1203863 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A6N8N962 |
| Locus tag | JMW65_RS06000 | Protein ID | WP_000065825.1 |
| Coordinates | 1203884..1204201 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW65_RS05970 | 1198585..1199760 | - | 1176 | WP_002914189.1 | multidrug efflux RND transporter periplasmic adaptor subunit OqxA | - |
| JMW65_RS05975 | 1200094..1200456 | + | 363 | WP_085783913.1 | helix-turn-helix domain-containing protein | - |
| JMW65_RS05980 | 1200467..1201039 | - | 573 | WP_004174789.1 | flavin reductase | - |
| JMW65_RS05985 | 1201251..1202135 | + | 885 | WP_094644920.1 | LysR family transcriptional regulator | - |
| JMW65_RS05990 | 1202260..1203060 | + | 801 | WP_004180956.1 | hypothetical protein | - |
| JMW65_RS05995 | 1203534..1203863 | - | 330 | WP_000854675.1 | TA system toxin CbtA family protein | Toxin |
| JMW65_RS06000 | 1203884..1204201 | - | 318 | WP_000065825.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMW65_RS06005 | 1204220..1204441 | - | 222 | WP_000691992.1 | DUF987 domain-containing protein | - |
| JMW65_RS06010 | 1204450..1204932 | - | 483 | WP_040083479.1 | DNA repair protein RadC | - |
| JMW65_RS06015 | 1204941..1205399 | - | 459 | WP_000211836.1 | antirestriction protein | - |
| JMW65_RS06020 | 1205573..1205724 | - | 152 | Protein_1179 | DUF905 family protein | - |
| JMW65_RS06025 | 1206212..1206907 | + | 696 | WP_196531411.1 | HNH endonuclease | - |
| JMW65_RS06030 | 1207360..1207548 | + | 189 | WP_001373566.1 | hypothetical protein | - |
| JMW65_RS06035 | 1207512..1207838 | + | 327 | WP_196531410.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12390.44 Da Isoelectric Point: 9.5496
>T290532 WP_000854675.1 NZ_LR890291:c1203863-1203534 [Klebsiella pneumoniae]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIKEHIDAGITLTEAVNFLVDKYELVRFDRKGF
SWQEQTPYISVVDILRARRSTGLLKANVK
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIKEHIDAGITLTEAVNFLVDKYELVRFDRKGF
SWQEQTPYISVVDILRARRSTGLLKANVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6N8NBW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6N8N962 |