Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 150521..151164 Replicon plasmid 2
Accession NZ_LR890289
Organism Escherichia coli isolate MSB1_1A-sc-2280383

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag JMW08_RS23835 Protein ID WP_001034044.1
Coordinates 150748..151164 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag JMW08_RS23830 Protein ID WP_001261286.1
Coordinates 150521..150751 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW08_RS23810 147152..147907 - 756 WP_000852146.1 replication initiation protein RepE -
JMW08_RS23815 148629..149435 - 807 WP_000016970.1 site-specific integrase -
JMW08_RS23820 149436..149741 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
JMW08_RS23825 149743..149961 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
JMW08_RS23830 150521..150751 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW08_RS23835 150748..151164 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW08_RS23840 151239..152804 + 1566 WP_001128474.1 AAA family ATPase -
JMW08_RS23845 152789..153811 + 1023 WP_000361402.1 helicase UvrD -
JMW08_RS23850 154065..154751 - 687 Protein_185 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..173787 173787
- flank IS/Tn - - 154065..154412 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T290525 WP_001034044.1 NZ_LR890289:150748-151164 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT290525 WP_001261286.1 NZ_LR890289:150521-150751 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References