Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 150521..151164 | Replicon | plasmid 2 |
Accession | NZ_LR890289 | ||
Organism | Escherichia coli isolate MSB1_1A-sc-2280383 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | JMW08_RS23835 | Protein ID | WP_001034044.1 |
Coordinates | 150748..151164 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | JMW08_RS23830 | Protein ID | WP_001261286.1 |
Coordinates | 150521..150751 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW08_RS23810 | 147152..147907 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
JMW08_RS23815 | 148629..149435 | - | 807 | WP_000016970.1 | site-specific integrase | - |
JMW08_RS23820 | 149436..149741 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
JMW08_RS23825 | 149743..149961 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
JMW08_RS23830 | 150521..150751 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW08_RS23835 | 150748..151164 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW08_RS23840 | 151239..152804 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
JMW08_RS23845 | 152789..153811 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
JMW08_RS23850 | 154065..154751 | - | 687 | Protein_185 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..173787 | 173787 | |
- | flank | IS/Tn | - | - | 154065..154412 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T290525 WP_001034044.1 NZ_LR890289:150748-151164 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |