Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 149436..149961 | Replicon | plasmid 2 |
| Accession | NZ_LR890289 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | JMW08_RS23820 | Protein ID | WP_001159871.1 |
| Coordinates | 149436..149741 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | JMW08_RS23825 | Protein ID | WP_000813630.1 |
| Coordinates | 149743..149961 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS23805 | 145398..146564 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| JMW08_RS23810 | 147152..147907 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| JMW08_RS23815 | 148629..149435 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| JMW08_RS23820 | 149436..149741 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMW08_RS23825 | 149743..149961 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMW08_RS23830 | 150521..150751 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| JMW08_RS23835 | 150748..151164 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| JMW08_RS23840 | 151239..152804 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| JMW08_RS23845 | 152789..153811 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| JMW08_RS23850 | 154065..154751 | - | 687 | Protein_185 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / tet(B) / catA1 / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..173787 | 173787 | |
| - | flank | IS/Tn | - | - | 154065..154412 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T290524 WP_001159871.1 NZ_LR890289:c149741-149436 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |