Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3502741..3503359 | Replicon | chromosome |
| Accession | NZ_LR890288 | ||
| Organism | Escherichia coli isolate MSB1_1A-sc-2280383 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | JMW08_RS16725 | Protein ID | WP_001291435.1 |
| Coordinates | 3503141..3503359 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | JMW08_RS16720 | Protein ID | WP_000344800.1 |
| Coordinates | 3502741..3503115 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW08_RS16710 | 3497830..3499023 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMW08_RS16715 | 3499046..3502195 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| JMW08_RS16720 | 3502741..3503115 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| JMW08_RS16725 | 3503141..3503359 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| JMW08_RS16730 | 3503531..3504082 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| JMW08_RS16735 | 3504198..3504668 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| JMW08_RS16740 | 3504832..3506382 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| JMW08_RS16745 | 3506424..3506777 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| JMW08_RS16755 | 3507156..3507467 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| JMW08_RS16760 | 3507498..3508070 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290506 WP_001291435.1 NZ_LR890288:3503141-3503359 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT290506 WP_000344800.1 NZ_LR890288:3502741-3503115 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |