Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1842426..1843261 | Replicon | chromosome |
Accession | NZ_LR890288 | ||
Organism | Escherichia coli isolate MSB1_1A-sc-2280383 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | JMW08_RS08750 | Protein ID | WP_042046912.1 |
Coordinates | 1842426..1842803 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | JMW08_RS08755 | Protein ID | WP_135145692.1 |
Coordinates | 1842893..1843261 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW08_RS08715 | 1837946..1838419 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
JMW08_RS08720 | 1838617..1839675 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
JMW08_RS08725 | 1839847..1840176 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
JMW08_RS08730 | 1840277..1840459 | - | 183 | WP_024198358.1 | ethanolamine utilization protein | - |
JMW08_RS08735 | 1840913..1841302 | - | 390 | WP_077875581.1 | transposase | - |
JMW08_RS08740 | 1842100..1842213 | - | 114 | WP_032140621.1 | DUF957 domain-containing protein | - |
JMW08_RS08745 | 1842226..1842429 | - | 204 | WP_000761705.1 | hypothetical protein | - |
JMW08_RS08750 | 1842426..1842803 | - | 378 | WP_042046912.1 | TA system toxin CbtA family protein | Toxin |
JMW08_RS08755 | 1842893..1843261 | - | 369 | WP_135145692.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW08_RS08760 | 1843424..1843645 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
JMW08_RS08765 | 1843708..1844184 | - | 477 | WP_001186774.1 | RadC family protein | - |
JMW08_RS08770 | 1844200..1844673 | - | 474 | WP_000855059.1 | antirestriction protein | - |
JMW08_RS08775 | 1844797..1845543 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
JMW08_RS08780 | 1845558..1847099 | - | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.96 Da Isoelectric Point: 7.8276
>T290499 WP_042046912.1 NZ_LR890288:c1842803-1842426 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13545.30 Da Isoelectric Point: 6.4764
>AT290499 WP_135145692.1 NZ_LR890288:c1843261-1842893 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|