Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 65312..66048 | Replicon | plasmid 3 |
Accession | NZ_LR890279 | ||
Organism | Klebsiella pneumoniae isolate INF355-sc-2280185 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | JMV94_RS26215 | Protein ID | WP_004187044.1 |
Coordinates | 65312..65794 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMV94_RS26220 | Protein ID | WP_003026799.1 |
Coordinates | 65782..66048 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV94_RS26190 | 61337..62273 | - | 937 | Protein_56 | ISNCY family transposase | - |
JMV94_RS26195 | 62383..62553 | + | 171 | Protein_57 | transposase | - |
JMV94_RS26200 | 62551..62658 | + | 108 | Protein_58 | IS3 family transposase | - |
JMV94_RS26205 | 62891..63595 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
JMV94_RS26210 | 63755..65101 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
JMV94_RS26215 | 65312..65794 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
JMV94_RS26220 | 65782..66048 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMV94_RS26225 | 66199..66903 | + | 705 | WP_060579418.1 | IS6-like element IS26 family transposase | - |
JMV94_RS26230 | 67062..69647 | - | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
JMV94_RS26235 | 69616..69861 | - | 246 | WP_032238678.1 | hypothetical protein | - |
JMV94_RS26240 | 69919..70899 | - | 981 | Protein_66 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 60174..70899 | 10725 | |
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..134665 | 134665 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T290478 WP_004187044.1 NZ_LR890279:c65794-65312 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|