Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 59894..60537 Replicon plasmid 2
Accession NZ_LR890278
Organism Klebsiella pneumoniae isolate INF355-sc-2280185

Toxin (Protein)


Gene name vagD Uniprot ID A0A5Q9LNG2
Locus tag JMV94_RS25205 Protein ID WP_048983057.1
Coordinates 59894..60310 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag JMV94_RS25210 Protein ID WP_016338373.1
Coordinates 60307..60537 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV94_RS25185 55817..56785 - 969 WP_000654811.1 IS5 family transposase -
JMV94_RS25190 56814..57050 - 237 Protein_66 colicin V synthesis protein -
JMV94_RS25195 57040..58317 - 1278 WP_016338369.1 HlyD family secretion protein -
JMV94_RS25200 58976..59853 + 878 Protein_68 restriction endonuclease -
JMV94_RS25205 59894..60310 - 417 WP_048983057.1 type II toxin-antitoxin system VapC family toxin Toxin
JMV94_RS25210 60307..60537 - 231 WP_016338373.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMV94_RS25215 61182..62198 - 1017 WP_001407551.1 IS5-like element IS5 family transposase -
JMV94_RS25220 62208..62876 - 669 WP_032249507.1 response regulator transcription factor -
JMV94_RS25225 63074..64042 - 969 WP_077265821.1 IS5 family transposase -
JMV94_RS25230 64372..64668 + 297 WP_001542733.1 helix-turn-helix domain-containing protein -
JMV94_RS25235 64930..65118 - 189 Protein_75 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B - 1..184852 184852
- inside IScluster/Tn - - 55817..64042 8225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15022.52 Da        Isoelectric Point: 9.2957

>T290476 WP_048983057.1 NZ_LR890278:c60310-59894 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT290476 WP_016338373.1 NZ_LR890278:c60537-60307 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNG2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References