Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4555546..4556062 | Replicon | chromosome |
| Accession | NZ_LR890277 | ||
| Organism | Klebsiella pneumoniae isolate INF355-sc-2280185 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | JMV94_RS22165 | Protein ID | WP_009309309.1 |
| Coordinates | 4555546..4555830 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMV94_RS22170 | Protein ID | WP_002886901.1 |
| Coordinates | 4555820..4556062 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV94_RS22140 | 4551029..4551337 | - | 309 | WP_016947038.1 | PTS sugar transporter subunit IIB | - |
| JMV94_RS22145 | 4551422..4551595 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| JMV94_RS22150 | 4551598..4552341 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| JMV94_RS22155 | 4552698..4554836 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMV94_RS22160 | 4555078..4555542 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMV94_RS22165 | 4555546..4555830 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV94_RS22170 | 4555820..4556062 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMV94_RS22175 | 4556140..4558050 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| JMV94_RS22180 | 4558073..4559227 | - | 1155 | WP_021313684.1 | lactonase family protein | - |
| JMV94_RS22185 | 4559294..4560034 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T290472 WP_009309309.1 NZ_LR890277:c4555830-4555546 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |