Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3847483..3848102 Replicon chromosome
Accession NZ_LR890277
Organism Klebsiella pneumoniae isolate INF355-sc-2280185

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMV94_RS18825 Protein ID WP_002892050.1
Coordinates 3847884..3848102 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMV94_RS18820 Protein ID WP_002892066.1
Coordinates 3847483..3847857 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV94_RS18810 3842635..3843828 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMV94_RS18815 3843851..3846997 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMV94_RS18820 3847483..3847857 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMV94_RS18825 3847884..3848102 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMV94_RS18830 3848265..3848831 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMV94_RS18835 3848803..3848943 - 141 WP_201524398.1 hypothetical protein -
JMV94_RS18840 3848964..3849434 + 471 WP_104159009.1 YlaC family protein -
JMV94_RS18845 3849409..3850860 - 1452 WP_201524399.1 PLP-dependent aminotransferase family protein -
JMV94_RS18850 3850961..3851659 + 699 WP_094310543.1 GNAT family N-acetyltransferase -
JMV94_RS18855 3851656..3851796 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMV94_RS18860 3851796..3852059 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -
JMV94_RS18865 3852201..3852797 + 597 Protein_3698 GNAT family N-acetyltransferase -
JMV94_RS18870 3852794..3852934 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290470 WP_002892050.1 NZ_LR890277:3847884-3848102 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290470 WP_002892066.1 NZ_LR890277:3847483-3847857 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References