Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325694..326280 Replicon chromosome
Accession NZ_LR890277
Organism Klebsiella pneumoniae isolate INF355-sc-2280185

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMV94_RS01515 Protein ID WP_002920800.1
Coordinates 325912..326280 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A485URP3
Locus tag JMV94_RS01510 Protein ID WP_040226701.1
Coordinates 325694..325915 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV94_RS01490 321851..322777 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMV94_RS01495 322774..324051 + 1278 WP_201524314.1 branched chain amino acid ABC transporter permease LivM -
JMV94_RS01500 324048..324815 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMV94_RS01505 324817..325530 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMV94_RS01510 325694..325915 + 222 WP_040226701.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMV94_RS01515 325912..326280 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMV94_RS01520 326553..327869 + 1317 WP_040226700.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMV94_RS01525 327976..328863 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMV94_RS01530 328860..329705 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMV94_RS01535 329707..330777 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 315212..331514 16302


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T290461 WP_002920800.1 NZ_LR890277:325912-326280 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8183.21 Da        Isoelectric Point: 4.7769

>AT290461 WP_040226701.1 NZ_LR890277:325694-325915 [Klebsiella pneumoniae]
MRTVNYSEARQNLADMLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A485URP3

References