Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 42611..43212 Replicon plasmid 4
Accession NZ_LR890273
Organism Escherichia coli isolate MINF_7C-sc-2280452

Toxin (Protein)


Gene name doc Uniprot ID A0A829IWB6
Locus tag JMW01_RS25465 Protein ID WP_016262419.1
Coordinates 42611..42991 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW01_RS25470 Protein ID WP_001190712.1
Coordinates 42991..43212 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW01_RS25435 38640..39668 + 1029 WP_201511052.1 tyrosine-type recombinase/integrase -
JMW01_RS25440 39741..40085 + 345 WP_201511053.1 hypothetical protein -
JMW01_RS25445 40082..40570 + 489 WP_016262423.1 hypothetical protein -
JMW01_RS25450 40567..41061 + 495 WP_201511054.1 dUTP diphosphatase -
JMW01_RS25455 41076..41726 + 651 WP_021551780.1 DUF2829 domain-containing protein -
JMW01_RS25460 41733..42530 + 798 WP_157209380.1 hypothetical protein -
JMW01_RS25465 42611..42991 - 381 WP_016262419.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW01_RS25470 42991..43212 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW01_RS25475 43321..43743 - 423 WP_016262418.1 hypothetical protein -
JMW01_RS25480 43878..44267 - 390 WP_068862856.1 DNA repair protein -
JMW01_RS25485 44367..44717 - 351 WP_201511055.1 hypothetical protein -
JMW01_RS25490 44743..44994 - 252 WP_001283837.1 DNA polymerase III subunit theta -
JMW01_RS25495 45168..45377 + 210 WP_201511057.1 hypothetical protein -
JMW01_RS25500 45434..46231 - 798 WP_201511058.1 hypothetical protein -
JMW01_RS25505 46228..46437 - 210 WP_201511056.1 hypothetical protein -
JMW01_RS25510 46462..46755 - 294 WP_124062609.1 hypothetical protein -
JMW01_RS25515 46768..47169 - 402 WP_201511038.1 hypothetical protein -
JMW01_RS25520 47346..47681 - 336 Protein_51 DUF550 domain-containing protein -
JMW01_RS25525 47658..48176 - 519 Protein_52 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..92830 92830


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13678.55 Da        Isoelectric Point: 5.6406

>T290459 WP_016262419.1 NZ_LR890273:c42991-42611 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT290459 WP_001190712.1 NZ_LR890273:c43212-42991 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829IWB6

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References