Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 12389..13033 | Replicon | plasmid 4 |
Accession | NZ_LR890273 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1C0Y1A0 |
Locus tag | JMW01_RS25310 | Protein ID | WP_029701816.1 |
Coordinates | 12851..13033 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | JMW01_RS25305 | Protein ID | WP_029701815.1 |
Coordinates | 12389..12820 (-) | Length | 144 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS25280 | 7433..7879 | + | 447 | WP_016262345.1 | hypothetical protein | - |
JMW01_RS25285 | 7869..8486 | + | 618 | WP_021551755.1 | hypothetical protein | - |
JMW01_RS25290 | 8483..10435 | + | 1953 | WP_068862840.1 | head protein | - |
JMW01_RS25295 | 10432..10800 | + | 369 | WP_016262342.1 | hypothetical protein | - |
JMW01_RS25300 | 10892..12277 | + | 1386 | WP_068862841.1 | hypothetical protein | - |
JMW01_RS25305 | 12389..12820 | - | 432 | WP_029701815.1 | hypothetical protein | Antitoxin |
JMW01_RS25310 | 12851..13033 | - | 183 | WP_029701816.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
JMW01_RS25315 | 13266..14951 | + | 1686 | WP_201511050.1 | phage portal protein | - |
JMW01_RS25320 | 14965..15963 | + | 999 | WP_021551762.1 | hypothetical protein | - |
JMW01_RS25325 | 16163..17125 | + | 963 | WP_068862843.1 | lytic replication protein | - |
JMW01_RS25330 | 17542..17766 | + | 225 | WP_000245715.1 | host cell division inhibitor Icd-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..92830 | 92830 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6850.97 Da Isoelectric Point: 10.9041
>T290458 WP_029701816.1 NZ_LR890273:c13033-12851 [Escherichia coli]
VKYSEFKRWLIQQGAEFRKAPGGGSHQKVNLNGKRSVFPDHGSKEMPEPLRKKIMKDLGL
VKYSEFKRWLIQQGAEFRKAPGGGSHQKVNLNGKRSVFPDHGSKEMPEPLRKKIMKDLGL
Download Length: 183 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15656.01 Da Isoelectric Point: 5.2844
>AT290458 WP_029701815.1 NZ_LR890273:c12820-12389 [Escherichia coli]
MFNYPVKLERDDKTGAYVVSCRDLPLFNSVGDSVEEALLEAGYGLVAAVAIEIEERRPVPTGSEPKEGEYVVSLPVLPAM
KAALHNAMIETGTRKAELARKLGKNGTQIDRLLDVEHSSKVETVELALHQLNKNIVVSVTPMR
MFNYPVKLERDDKTGAYVVSCRDLPLFNSVGDSVEEALLEAGYGLVAAVAIEIEERRPVPTGSEPKEGEYVVSLPVLPAM
KAALHNAMIETGTRKAELARKLGKNGTQIDRLLDVEHSSKVETVELALHQLNKNIVVSVTPMR
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|