Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 104453..105096 | Replicon | plasmid 2 |
Accession | NZ_LR890271 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | JMW01_RS24600 | Protein ID | WP_001044768.1 |
Coordinates | 104453..104869 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | JMW01_RS24605 | Protein ID | WP_001261287.1 |
Coordinates | 104866..105096 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS24585 | 100952..101542 | - | 591 | WP_000194575.1 | hypothetical protein | - |
JMW01_RS24590 | 101542..101799 | - | 258 | WP_000343085.1 | hypothetical protein | - |
JMW01_RS24595 | 102153..104291 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
JMW01_RS24600 | 104453..104869 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW01_RS24605 | 104866..105096 | - | 231 | WP_001261287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW01_RS24610 | 105392..105682 | + | 291 | WP_000111771.1 | hypothetical protein | - |
JMW01_RS24615 | 105672..106571 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
JMW01_RS24620 | 106621..107160 | - | 540 | Protein_127 | exclusion suppressor FxsA | - |
JMW01_RS24625 | 107253..108752 | + | 1500 | WP_000174402.1 | IS21-like element ISEc10 family transposase | - |
JMW01_RS24630 | 108749..109504 | + | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / aac(3)-IIa / sitABCD / tet(A) | - | 1..118421 | 118421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T290452 WP_001044768.1 NZ_LR890271:c104869-104453 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |