Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4846843..4847627 | Replicon | chromosome |
Accession | NZ_LR890270 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | JMW01_RS22780 | Protein ID | WP_000613626.1 |
Coordinates | 4846843..4847337 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | JMW01_RS22785 | Protein ID | WP_001110447.1 |
Coordinates | 4847334..4847627 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS22760 | 4842036..4843133 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
JMW01_RS22765 | 4843133..4844074 | + | 942 | WP_001586904.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
JMW01_RS22770 | 4844140..4845783 | + | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
JMW01_RS22775 | 4845795..4846748 | + | 954 | WP_001586905.1 | flagellar hook-associated protein FlgL | - |
JMW01_RS22780 | 4846843..4847337 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
JMW01_RS22785 | 4847334..4847627 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
JMW01_RS22790 | 4847760..4850945 | - | 3186 | WP_001522867.1 | ribonuclease E | - |
JMW01_RS22795 | 4851518..4852477 | + | 960 | WP_001586906.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T290443 WP_000613626.1 NZ_LR890270:c4847337-4846843 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|