Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 4603889..4604594 | Replicon | chromosome |
Accession | NZ_LR890270 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | JMW01_RS21630 | Protein ID | WP_000539521.1 |
Coordinates | 4604208..4604594 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMW01_RS21625 | Protein ID | WP_001280945.1 |
Coordinates | 4603889..4604218 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS21610 | 4599046..4599957 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
JMW01_RS21615 | 4600135..4602483 | + | 2349 | WP_001305945.1 | EAL domain-containing protein | - |
JMW01_RS21620 | 4602491..4603819 | + | 1329 | WP_001586846.1 | GGDEF domain-containing protein | - |
JMW01_RS21625 | 4603889..4604218 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
JMW01_RS21630 | 4604208..4604594 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW01_RS21635 | 4604820..4606145 | - | 1326 | WP_201510937.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
JMW01_RS21640 | 4606358..4606741 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
JMW01_RS21645 | 4606852..4607967 | + | 1116 | WP_000555033.1 | aldose sugar dehydrogenase YliI | - |
JMW01_RS21650 | 4607964..4608590 | - | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T290442 WP_000539521.1 NZ_LR890270:c4604594-4604208 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|