Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4149406..4150024 | Replicon | chromosome |
Accession | NZ_LR890270 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | JMW01_RS19510 | Protein ID | WP_001291435.1 |
Coordinates | 4149406..4149624 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | JMW01_RS19515 | Protein ID | WP_000344800.1 |
Coordinates | 4149650..4150024 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS19475 | 4144695..4145267 | + | 573 | WP_000779833.1 | YbaY family lipoprotein | - |
JMW01_RS19480 | 4145298..4145609 | - | 312 | WP_000409911.1 | MGMT family protein | - |
JMW01_RS19490 | 4145988..4146341 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
JMW01_RS19495 | 4146383..4147933 | - | 1551 | WP_001305493.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
JMW01_RS19500 | 4148097..4148567 | - | 471 | WP_000136192.1 | YlaC family protein | - |
JMW01_RS19505 | 4148683..4149234 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
JMW01_RS19510 | 4149406..4149624 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
JMW01_RS19515 | 4149650..4150024 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
JMW01_RS19520 | 4150570..4153719 | - | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
JMW01_RS19525 | 4153742..4154935 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290441 WP_001291435.1 NZ_LR890270:c4149624-4149406 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT290441 WP_000344800.1 NZ_LR890270:c4150024-4149650 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |