Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3699972..3700396 Replicon chromosome
Accession NZ_LR890270
Organism Escherichia coli isolate MINF_7C-sc-2280452

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag JMW01_RS17465 Protein ID WP_001586653.1
Coordinates 3700208..3700396 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag JMW01_RS17460 Protein ID WP_000125566.1
Coordinates 3699972..3700205 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW01_RS17435 3695045..3695332 + 288 WP_000203747.1 ferredoxin-like protein FixX -
JMW01_RS17440 3695391..3696722 + 1332 WP_001183198.1 MFS transporter -
JMW01_RS17445 3696830..3697360 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
JMW01_RS17450 3697353..3699215 + 1863 WP_000377113.1 glutathione-regulated potassium-efflux system protein KefC -
JMW01_RS17455 3699407..3699886 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
JMW01_RS17460 3699972..3700205 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
JMW01_RS17465 3700208..3700396 + 189 WP_001586653.1 CcdB family protein Toxin
JMW01_RS17470 3700393..3700509 + 117 WP_001389634.1 CcdB family protein -
JMW01_RS17475 3700506..3701354 - 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
JMW01_RS17480 3701361..3701738 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
JMW01_RS17485 3701741..3702562 - 822 WP_001065361.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
JMW01_RS17490 3702559..3703548 - 990 WP_000241280.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
JMW01_RS17495 3703548..3704834 - 1287 WP_000800470.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-57)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7029.22 Da        Isoelectric Point: 8.7938

>T290438 WP_001586653.1 NZ_LR890270:3700208-3700396 [Escherichia coli]
MQFTVYRSRGSNAAFPFVIDVTSDIIGEINRSIVIPLTPIERFIRIRPPERLNTILLLVDGS

Download         Length: 189 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT290438 WP_000125566.1 NZ_LR890270:3699972-3700205 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References