Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 223592..224230 | Replicon | chromosome |
Accession | NZ_LR890270 | ||
Organism | Escherichia coli isolate MINF_7C-sc-2280452 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | D3GRG9 |
Locus tag | JMW01_RS01170 | Protein ID | WP_001314712.1 |
Coordinates | 223592..223768 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | JMW01_RS01175 | Protein ID | WP_077248684.1 |
Coordinates | 223814..224230 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW01_RS01150 | 219214..220425 | - | 1212 | WP_071593600.1 | BenE family transporter YdcO | - |
JMW01_RS01155 | 220478..221014 | + | 537 | WP_000429149.1 | DNA-binding transcriptional regulator SutR | - |
JMW01_RS01160 | 221087..223048 | + | 1962 | WP_001587031.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
JMW01_RS01165 | 223140..223370 | - | 231 | WP_000494241.1 | YncJ family protein | - |
JMW01_RS01170 | 223592..223768 | + | 177 | WP_001314712.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
JMW01_RS01175 | 223814..224230 | + | 417 | WP_077248684.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
JMW01_RS01180 | 224309..225715 | + | 1407 | WP_000760623.1 | PLP-dependent aminotransferase family protein | - |
JMW01_RS01185 | 225960..227093 | + | 1134 | WP_064770230.1 | ABC transporter substrate-binding protein | - |
JMW01_RS01190 | 227111..228124 | + | 1014 | WP_000220407.1 | ABC transporter ATP-binding protein | - |
JMW01_RS01195 | 228125..229066 | + | 942 | WP_001587036.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6746.81 Da Isoelectric Point: 11.8888
>T290423 WP_001314712.1 NZ_LR890270:223592-223768 [Escherichia coli]
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15232.60 Da Isoelectric Point: 4.7286
>AT290423 WP_077248684.1 NZ_LR890270:223814-224230 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|