Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53667..54403 | Replicon | plasmid 2 |
Accession | NZ_LR890246 | ||
Organism | Klebsiella pneumoniae isolate INF174-sc-2280034 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | JMV74_RS25950 | Protein ID | WP_003026803.1 |
Coordinates | 53921..54403 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMV74_RS25945 | Protein ID | WP_003026799.1 |
Coordinates | 53667..53933 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV74_RS25900 | 49729..50091 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
JMV74_RS25905 | 50141..50491 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
JMV74_RS25910 | 50849..51118 | + | 270 | WP_004152102.1 | hypothetical protein | - |
JMV74_RS25915 | 51106..51681 | + | 576 | WP_004152103.1 | hypothetical protein | - |
JMV74_RS25920 | 51712..52206 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
JMV74_RS25925 | 52250..52618 | + | 369 | WP_004152105.1 | hypothetical protein | - |
JMV74_RS25930 | 52652..52855 | + | 204 | WP_004152106.1 | hemolysin expression modulator Hha | - |
JMV74_RS25935 | 52904..53161 | + | 258 | WP_004152107.1 | hypothetical protein | - |
JMV74_RS25940 | 53237..53491 | + | 255 | WP_004152108.1 | hypothetical protein | - |
JMV74_RS25945 | 53667..53933 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMV74_RS25950 | 53921..54403 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
JMV74_RS25955 | 54615..55961 | + | 1347 | WP_077256225.1 | ISNCY family transposase | - |
JMV74_RS25960 | 56462..57716 | - | 1255 | Protein_57 | IS3 family transposase | - |
JMV74_RS25965 | 57804..58766 | - | 963 | WP_004152113.1 | M48 family metalloprotease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(D) / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / dfrA14 / aph(3')-Ia / sul1 / catA1 | - | 1..238703 | 238703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T290399 WP_003026803.1 NZ_LR890246:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |