Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3971649..3972268 Replicon chromosome
Accession NZ_LR890240
Organism Klebsiella pneumoniae isolate INF329-sc-2280137

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMV78_RS19320 Protein ID WP_002892050.1
Coordinates 3972050..3972268 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMV78_RS19315 Protein ID WP_002892066.1
Coordinates 3971649..3972023 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV78_RS19305 3966801..3967994 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMV78_RS19310 3968017..3971163 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMV78_RS19315 3971649..3972023 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMV78_RS19320 3972050..3972268 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMV78_RS19325 3972427..3972993 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMV78_RS19330 3972965..3973105 - 141 WP_004147370.1 hypothetical protein -
JMV78_RS19335 3973126..3973596 + 471 WP_002892026.1 YlaC family protein -
JMV78_RS19340 3973571..3975022 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMV78_RS19345 3975123..3975821 + 699 WP_004177238.1 GNAT family N-acetyltransferase -
JMV78_RS19350 3975818..3975958 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMV78_RS19355 3975958..3976221 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290381 WP_002892050.1 NZ_LR890240:3972050-3972268 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290381 WP_002892066.1 NZ_LR890240:3971649-3972023 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References