Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 147522..148273 | Replicon | plasmid 2 |
Accession | NZ_LR890236 | ||
Organism | Klebsiella pneumoniae isolate INF334-sc-2280143 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | JMV98_RS26240 | Protein ID | WP_071359904.1 |
Coordinates | 147522..148004 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | JMV98_RS26245 | Protein ID | WP_004902250.1 |
Coordinates | 147995..148273 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV98_RS26220 | 142950..144020 | - | 1071 | WP_071359900.1 | PD-(D/E)XK nuclease family protein | - |
JMV98_RS26225 | 144288..145240 | + | 953 | Protein_155 | hypothetical protein | - |
JMV98_RS26230 | 145497..146354 | - | 858 | WP_201520345.1 | DUF4365 domain-containing protein | - |
JMV98_RS26235 | 146597..147322 | - | 726 | WP_071359903.1 | hypothetical protein | - |
JMV98_RS26240 | 147522..148004 | - | 483 | WP_071359904.1 | GNAT family N-acetyltransferase | Toxin |
JMV98_RS26245 | 147995..148273 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
JMV98_RS26250 | 148664..149005 | - | 342 | WP_154908308.1 | hypothetical protein | - |
JMV98_RS26255 | 149402..149728 | - | 327 | WP_075209941.1 | hypothetical protein | - |
JMV98_RS26260 | 149772..149882 | + | 111 | Protein_162 | glutathione ABC transporter permease GsiC | - |
JMV98_RS26265 | 149966..151636 | - | 1671 | WP_071359906.1 | AMP-binding protein | - |
JMV98_RS26270 | 151617..152882 | - | 1266 | WP_048281137.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
JMV98_RS26275 | 152900..153190 | - | 291 | WP_032413253.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..169535 | 169535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17650.29 Da Isoelectric Point: 9.1569
>T290371 WP_071359904.1 NZ_LR890236:c148004-147522 [Klebsiella pneumoniae]
MGMRSPESLTPEHNLSEFCCQEPGLNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLATDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKGFYTRFGFEPSIVNTLTLLFPVKV
MGMRSPESLTPEHNLSEFCCQEPGLNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLATDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKGFYTRFGFEPSIVNTLTLLFPVKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|