Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 23565..24475 | Replicon | plasmid 2 |
Accession | NZ_LR890236 | ||
Organism | Klebsiella pneumoniae isolate INF334-sc-2280143 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | JMV98_RS25600 | Protein ID | WP_071359843.1 |
Coordinates | 24005..24475 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A6P1V3Q9 |
Locus tag | JMV98_RS25595 | Protein ID | WP_004026357.1 |
Coordinates | 23565..24008 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV98_RS25570 | 19348..19686 | - | 339 | WP_071359842.1 | hypothetical protein | - |
JMV98_RS25575 | 19885..20607 | + | 723 | Protein_25 | DUF969 domain-containing protein | - |
JMV98_RS25580 | 20604..21590 | + | 987 | Protein_26 | DUF979 domain-containing protein | - |
JMV98_RS25585 | 21600..22595 | + | 996 | WP_049084154.1 | DUF2891 domain-containing protein | - |
JMV98_RS25590 | 22756..23443 | + | 688 | Protein_28 | DUF4113 domain-containing protein | - |
JMV98_RS25595 | 23565..24008 | + | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
JMV98_RS25600 | 24005..24475 | + | 471 | WP_071359843.1 | RES family NAD+ phosphorylase | Toxin |
JMV98_RS25605 | 24586..24846 | - | 261 | WP_004026352.1 | hypothetical protein | - |
JMV98_RS25610 | 25569..25727 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
JMV98_RS25615 | 26378..26545 | - | 168 | WP_004117900.1 | hypothetical protein | - |
JMV98_RS25620 | 26935..27425 | + | 491 | Protein_34 | hypothetical protein | - |
JMV98_RS25625 | 27794..28349 | - | 556 | Protein_35 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..169535 | 169535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17587.85 Da Isoelectric Point: 4.5152
>T290370 WP_071359843.1 NZ_LR890236:24005-24475 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDTFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDTFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT290370 WP_004026357.1 NZ_LR890236:23565-24008 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|