Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5159422..5160047 | Replicon | chromosome |
Accession | NZ_LR890235 | ||
Organism | Klebsiella pneumoniae isolate INF334-sc-2280143 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | JMV98_RS25085 | Protein ID | WP_002882817.1 |
Coordinates | 5159422..5159805 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | JMV98_RS25090 | Protein ID | WP_162557435.1 |
Coordinates | 5159805..5160047 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV98_RS25070 | 5156788..5157690 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMV98_RS25075 | 5157687..5158322 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMV98_RS25080 | 5158319..5159248 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMV98_RS25085 | 5159422..5159805 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMV98_RS25090 | 5159805..5160047 | - | 243 | WP_162557435.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMV98_RS25095 | 5160252..5161169 | + | 918 | WP_032417884.1 | alpha/beta hydrolase | - |
JMV98_RS25100 | 5161184..5162125 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMV98_RS25105 | 5162170..5162607 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMV98_RS25110 | 5162604..5163464 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
JMV98_RS25115 | 5163458..5164057 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T290369 WP_002882817.1 NZ_LR890235:c5159805-5159422 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|