Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4601076..4601779 | Replicon | chromosome |
Accession | NZ_LR890235 | ||
Organism | Klebsiella pneumoniae isolate INF334-sc-2280143 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMV98_RS22450 | Protein ID | WP_017880111.1 |
Coordinates | 4601076..4601417 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | JMV98_RS22455 | Protein ID | WP_050131139.1 |
Coordinates | 4601438..4601779 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV98_RS22420 | 4596281..4596955 | + | 675 | WP_004186809.1 | hypothetical protein | - |
JMV98_RS22425 | 4596957..4597304 | + | 348 | WP_004186808.1 | hypothetical protein | - |
JMV98_RS22430 | 4597307..4597786 | + | 480 | WP_004192264.1 | type VI secretion system tube protein Hcp | - |
JMV98_RS22435 | 4597979..4598307 | - | 329 | Protein_4398 | hypothetical protein | - |
JMV98_RS22440 | 4598326..4599437 | - | 1112 | Protein_4399 | IS3 family transposase | - |
JMV98_RS22445 | 4599805..4600812 | - | 1008 | WP_017880110.1 | restriction endonuclease | - |
JMV98_RS22450 | 4601076..4601417 | - | 342 | WP_017880111.1 | TA system toxin CbtA family protein | Toxin |
JMV98_RS22455 | 4601438..4601779 | - | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMV98_RS22460 | 4601790..4602332 | - | 543 | WP_017880113.1 | DNA repair protein RadC | - |
JMV98_RS22465 | 4602345..4602788 | - | 444 | WP_032417797.1 | antirestriction protein | - |
JMV98_RS22470 | 4602819..4603640 | - | 822 | WP_032417795.1 | DUF945 domain-containing protein | - |
JMV98_RS22475 | 4603761..4604234 | - | 474 | WP_031280324.1 | hypothetical protein | - |
JMV98_RS22480 | 4604306..4604758 | - | 453 | WP_031280325.1 | hypothetical protein | - |
JMV98_RS22485 | 4604794..4605510 | - | 717 | WP_032417794.1 | WYL domain-containing protein | - |
JMV98_RS22490 | 4605754..4606629 | - | 876 | WP_017880120.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4596957..4628285 | 31328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12811.73 Da Isoelectric Point: 8.4941
>T290366 WP_017880111.1 NZ_LR890235:c4601417-4601076 [Klebsiella pneumoniae]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|