Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4567896..4568706 | Replicon | chromosome |
| Accession | NZ_LR890230 | ||
| Organism | Klebsiella pneumoniae isolate KSB1_6J | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | JMW15_RS22140 | Protein ID | WP_040148415.1 |
| Coordinates | 4567896..4568429 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | JMW15_RS22145 | Protein ID | WP_002887278.1 |
| Coordinates | 4568440..4568706 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW15_RS22135 | 4566727..4567848 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
| JMW15_RS22140 | 4567896..4568429 | - | 534 | WP_040148415.1 | GNAT family N-acetyltransferase | Toxin |
| JMW15_RS22145 | 4568440..4568706 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW15_RS22150 | 4568809..4570242 | - | 1434 | WP_040148413.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| JMW15_RS22155 | 4570232..4570915 | - | 684 | WP_020804437.1 | copper response regulator transcription factor CusR | - |
| JMW15_RS22160 | 4571087..4572472 | + | 1386 | WP_040148411.1 | efflux transporter outer membrane subunit | - |
| JMW15_RS22165 | 4572490..4572834 | + | 345 | WP_040148409.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19909.78 Da Isoelectric Point: 5.7068
>T290351 WP_040148415.1 NZ_LR890230:c4568429-4567896 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSRDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|