Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3967765..3968384 | Replicon | chromosome |
Accession | NZ_LR890230 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6J |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | JMW15_RS19305 | Protein ID | WP_002892050.1 |
Coordinates | 3968166..3968384 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | JMW15_RS19300 | Protein ID | WP_002892066.1 |
Coordinates | 3967765..3968139 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW15_RS19290 | 3962917..3964110 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMW15_RS19295 | 3964133..3967279 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
JMW15_RS19300 | 3967765..3968139 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
JMW15_RS19305 | 3968166..3968384 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
JMW15_RS19310 | 3968543..3969109 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
JMW15_RS19315 | 3969081..3969221 | - | 141 | WP_004147370.1 | hypothetical protein | - |
JMW15_RS19320 | 3969242..3969712 | + | 471 | WP_002892026.1 | YlaC family protein | - |
JMW15_RS19325 | 3969687..3971138 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
JMW15_RS19330 | 3971239..3971937 | + | 699 | WP_004177238.1 | GNAT family N-acetyltransferase | - |
JMW15_RS19335 | 3971934..3972074 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
JMW15_RS19340 | 3972074..3972337 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290350 WP_002892050.1 NZ_LR890230:3968166-3968384 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT290350 WP_002892066.1 NZ_LR890230:3967765-3968139 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |