Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 51401..52137 | Replicon | plasmid 2 |
| Accession | NZ_LR890218 | ||
| Organism | Klebsiella pneumoniae isolate INF357-sc-2280189 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | JMV73_RS25595 | Protein ID | WP_023329018.1 |
| Coordinates | 51401..51883 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMV73_RS25600 | Protein ID | WP_003026799.1 |
| Coordinates | 51871..52137 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV73_RS25570 | 46462..47430 | + | 969 | WP_077254073.1 | IS5 family transposase | - |
| JMV73_RS25575 | 47682..48093 | + | 412 | Protein_54 | hypothetical protein | - |
| JMV73_RS25580 | 48381..48953 | + | 573 | WP_032738445.1 | recombinase family protein | - |
| JMV73_RS25585 | 48962..49780 | + | 819 | WP_023307220.1 | abortive infection family protein | - |
| JMV73_RS25590 | 49851..51194 | - | 1344 | WP_077263966.1 | ISNCY family transposase | - |
| JMV73_RS25595 | 51401..51883 | - | 483 | WP_023329018.1 | GNAT family N-acetyltransferase | Toxin |
| JMV73_RS25600 | 51871..52137 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMV73_RS25605 | 53241..53420 | + | 180 | Protein_60 | transposase | - |
| JMV73_RS25610 | 53387..53521 | + | 135 | WP_109241503.1 | integrase core domain-containing protein | - |
| JMV73_RS25615 | 53673..54482 | - | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| JMV73_RS25620 | 54475..55683 | - | 1209 | WP_023329016.1 | imidazolonepropionase | - |
| JMV73_RS25625 | 55695..57089 | - | 1395 | WP_032738443.1 | cytosine permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..192965 | 192965 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17255.84 Da Isoelectric Point: 7.8840
>T290338 WP_023329018.1 NZ_LR890218:c51883-51401 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAEGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|