Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4659376..4659892 | Replicon | chromosome |
Accession | NZ_LR890217 | ||
Organism | Klebsiella pneumoniae isolate INF357-sc-2280189 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | JMV73_RS22640 | Protein ID | WP_009309309.1 |
Coordinates | 4659376..4659660 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMV73_RS22645 | Protein ID | WP_002886901.1 |
Coordinates | 4659650..4659892 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV73_RS22615 | 4654860..4655168 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
JMV73_RS22620 | 4655253..4655426 | + | 174 | WP_002886906.1 | hypothetical protein | - |
JMV73_RS22625 | 4655429..4656172 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMV73_RS22630 | 4656529..4658667 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMV73_RS22635 | 4658908..4659372 | + | 465 | WP_047718307.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMV73_RS22640 | 4659376..4659660 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV73_RS22645 | 4659650..4659892 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMV73_RS22650 | 4659970..4661880 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMV73_RS22655 | 4661903..4663057 | - | 1155 | WP_047718309.1 | lactonase family protein | - |
JMV73_RS22660 | 4663124..4663864 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T290336 WP_009309309.1 NZ_LR890217:c4659660-4659376 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |