Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4572363..4573066 | Replicon | chromosome |
Accession | NZ_LR890217 | ||
Organism | Klebsiella pneumoniae isolate INF357-sc-2280189 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMV73_RS22255 | Protein ID | WP_017880111.1 |
Coordinates | 4572363..4572704 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | JMV73_RS22260 | Protein ID | WP_050131139.1 |
Coordinates | 4572725..4573066 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV73_RS22225 | 4567376..4567642 | + | 267 | WP_004178415.1 | hypothetical protein | - |
JMV73_RS22230 | 4567642..4568314 | + | 673 | Protein_4357 | DUF4400 domain-containing protein | - |
JMV73_RS22235 | 4568325..4569209 | + | 885 | WP_101971444.1 | RES domain-containing protein | - |
JMV73_RS22240 | 4569408..4569596 | - | 189 | Protein_4359 | transposase | - |
JMV73_RS22245 | 4569613..4570724 | - | 1112 | Protein_4360 | IS3 family transposase | - |
JMV73_RS22250 | 4571092..4572099 | - | 1008 | WP_017880110.1 | restriction endonuclease | - |
JMV73_RS22255 | 4572363..4572704 | - | 342 | WP_017880111.1 | TA system toxin CbtA family protein | Toxin |
JMV73_RS22260 | 4572725..4573066 | - | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMV73_RS22265 | 4573077..4573619 | - | 543 | WP_017880113.1 | DNA repair protein RadC | - |
JMV73_RS22270 | 4573632..4574075 | - | 444 | WP_032417797.1 | antirestriction protein | - |
JMV73_RS22275 | 4574106..4574927 | - | 822 | WP_032417795.1 | DUF945 domain-containing protein | - |
JMV73_RS22280 | 4575048..4575521 | - | 474 | WP_031280324.1 | hypothetical protein | - |
JMV73_RS22285 | 4575593..4576045 | - | 453 | WP_031280325.1 | hypothetical protein | - |
JMV73_RS22290 | 4576081..4576797 | - | 717 | WP_032417794.1 | WYL domain-containing protein | - |
JMV73_RS22295 | 4577041..4577916 | - | 876 | WP_017880120.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4559595..4600638 | 41043 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12811.73 Da Isoelectric Point: 8.4941
>T290335 WP_017880111.1 NZ_LR890217:c4572704-4572363 [Klebsiella pneumoniae]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|