Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3922993..3923612 Replicon chromosome
Accession NZ_LR890217
Organism Klebsiella pneumoniae isolate INF357-sc-2280189

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMV73_RS19135 Protein ID WP_002892050.1
Coordinates 3923394..3923612 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMV73_RS19130 Protein ID WP_002892066.1
Coordinates 3922993..3923367 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV73_RS19120 3918145..3919338 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMV73_RS19125 3919361..3922507 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit -
JMV73_RS19130 3922993..3923367 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMV73_RS19135 3923394..3923612 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMV73_RS19140 3923771..3924337 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMV73_RS19145 3924309..3924449 - 141 WP_004147370.1 hypothetical protein -
JMV73_RS19150 3924470..3924940 + 471 WP_002892026.1 YlaC family protein -
JMV73_RS19155 3924915..3926366 - 1452 WP_101971061.1 PLP-dependent aminotransferase family protein -
JMV73_RS19160 3926467..3927165 + 699 WP_040220001.1 GNAT family N-acetyltransferase -
JMV73_RS19165 3927162..3927302 - 141 WP_040219999.1 type B 50S ribosomal protein L36 -
JMV73_RS19170 3927302..3927565 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290333 WP_002892050.1 NZ_LR890217:3923394-3923612 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290333 WP_002892066.1 NZ_LR890217:3922993-3923367 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References