Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 93031..93556 Replicon plasmid 3
Accession NZ_LR890211
Organism Klebsiella pneumoniae isolate INF022-sc-2279895

Toxin (Protein)


Gene name ccdB Uniprot ID A0A9E1GGX2
Locus tag JMW18_RS27200 Protein ID WP_016946795.1
Coordinates 93031..93336 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A9E1GDP8
Locus tag JMW18_RS27205 Protein ID WP_004197642.1
Coordinates 93338..93556 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW18_RS27170 88836..89105 + 270 WP_000339857.1 hypothetical protein -
JMW18_RS27175 89462..90328 - 867 WP_004118283.1 replication initiation protein -
JMW18_RS27180 90863..90967 + 105 WP_032409716.1 hypothetical protein -
JMW18_RS27185 91096..91353 + 258 WP_000764642.1 hypothetical protein -
JMW18_RS27190 91411..92187 - 777 WP_049245386.1 site-specific integrase -
JMW18_RS27195 92190..92873 - 684 WP_023280892.1 hypothetical protein -
JMW18_RS27200 93031..93336 - 306 WP_016946795.1 type II toxin-antitoxin system toxin CcdB Toxin
JMW18_RS27205 93338..93556 - 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMW18_RS27210 94120..94632 + 513 WP_117326276.1 hypothetical protein -
JMW18_RS27215 94666..95799 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
JMW18_RS27220 95966..96739 - 774 WP_117326274.1 hypothetical protein -
JMW18_RS27225 96752..97252 - 501 WP_201519577.1 hypothetical protein -
JMW18_RS27230 97527..97790 + 264 WP_182243435.1 hypothetical protein -
JMW18_RS27235 97787..98353 + 567 WP_013023777.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..111450 111450


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11548.22 Da        Isoelectric Point: 5.6831

>T290323 WP_016946795.1 NZ_LR890211:c93336-93031 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8376.34 Da        Isoelectric Point: 4.7405

>AT290323 WP_004197642.1 NZ_LR890211:c93556-93338 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References