Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 52056..52792 | Replicon | plasmid 3 |
Accession | NZ_LR890211 | ||
Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A443XD13 |
Locus tag | JMW18_RS26990 | Protein ID | WP_075253142.1 |
Coordinates | 52310..52792 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | JMW18_RS26985 | Protein ID | WP_049083184.1 |
Coordinates | 52056..52322 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW18_RS26960 | 47334..47708 | - | 375 | WP_008786685.1 | fluoride efflux transporter CrcB | - |
JMW18_RS26965 | 47743..48429 | - | 687 | WP_141409893.1 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase | - |
JMW18_RS26970 | 48748..50034 | - | 1287 | WP_074091243.1 | phosphopyruvate hydratase | - |
JMW18_RS26975 | 50050..50478 | - | 429 | WP_131025045.1 | universal stress protein | - |
JMW18_RS26980 | 50482..51444 | - | 963 | WP_141409894.1 | manganese-dependent inorganic pyrophosphatase | - |
JMW18_RS26985 | 52056..52322 | + | 267 | WP_049083184.1 | DUF1778 domain-containing protein | Antitoxin |
JMW18_RS26990 | 52310..52792 | + | 483 | WP_075253142.1 | GNAT family N-acetyltransferase | Toxin |
JMW18_RS26995 | 53353..54321 | + | 969 | WP_004099053.1 | IS5-like element IS903B family transposase | - |
JMW18_RS27000 | 54381..55085 | - | 705 | WP_141409897.1 | IS6 family transposase | - |
JMW18_RS27005 | 55670..56662 | + | 993 | WP_001145103.1 | hypothetical protein | - |
JMW18_RS27010 | 56798..57426 | - | 629 | Protein_58 | DUF2913 family protein | - |
JMW18_RS27015 | 57480..57761 | - | 282 | WP_001568067.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..111450 | 111450 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17254.90 Da Isoelectric Point: 8.7400
>T290322 WP_075253142.1 NZ_LR890211:52310-52792 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|