Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 155219..155745 | Replicon | plasmid 2 |
| Accession | NZ_LR890210 | ||
| Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | JMW18_RS26480 | Protein ID | WP_000323025.1 |
| Coordinates | 155219..155506 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | J5W3H0 |
| Locus tag | JMW18_RS26485 | Protein ID | WP_004196370.1 |
| Coordinates | 155506..155745 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW18_RS26450 | 150906..151223 | - | 318 | WP_015065519.1 | hypothetical protein | - |
| JMW18_RS26455 | 151238..151588 | - | 351 | WP_032425551.1 | hypothetical protein | - |
| JMW18_RS26460 | 151585..151857 | - | 273 | WP_032425552.1 | hypothetical protein | - |
| JMW18_RS26465 | 152713..153825 | - | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
| JMW18_RS26470 | 153904..154062 | - | 159 | WP_014343509.1 | type I toxin-antitoxin system Hok family toxin | - |
| JMW18_RS26475 | 154134..155168 | + | 1035 | Protein_165 | IS481 family transposase | - |
| JMW18_RS26480 | 155219..155506 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| JMW18_RS26485 | 155506..155745 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| JMW18_RS26490 | 155996..156361 | + | 366 | WP_009651956.1 | hypothetical protein | - |
| JMW18_RS26495 | 156405..157142 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
| JMW18_RS26500 | 157156..157845 | + | 690 | WP_004196322.1 | hypothetical protein | - |
| JMW18_RS26505 | 157876..159252 | - | 1377 | Protein_171 | chromate efflux transporter | - |
| JMW18_RS26510 | 159209..160186 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
| JMW18_RS26515 | 160216..160408 | + | 193 | Protein_173 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..197166 | 197166 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T290321 WP_000323025.1 NZ_LR890210:c155506-155219 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|