Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 51078..51814 Replicon plasmid 2
Accession NZ_LR890210
Organism Klebsiella pneumoniae isolate INF022-sc-2279895

Toxin (Protein)


Gene name tacT Uniprot ID A0A2J5Q928
Locus tag JMW18_RS25935 Protein ID WP_004098919.1
Coordinates 51332..51814 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID A0A455TK27
Locus tag JMW18_RS25930 Protein ID WP_020804426.1
Coordinates 51078..51344 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW18_RS25880 46813..47160 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
JMW18_RS25885 47157..47561 - 405 WP_023290559.1 IS66 family insertion sequence hypothetical protein -
JMW18_RS25890 48073..48171 - 99 WP_004118688.1 type II toxin-antitoxin system RelE/ParE family toxin -
JMW18_RS25895 48158..48337 - 180 WP_004118349.1 type II toxin-antitoxin system ParD family antitoxin -
JMW18_RS25900 48651..48914 + 264 WP_004118691.1 hypothetical protein -
JMW18_RS25905 48911..49477 + 567 WP_042922197.1 hypothetical protein -
JMW18_RS25910 49508..50002 + 495 WP_016528789.1 hypothetical protein -
JMW18_RS25915 50063..50266 + 204 WP_004150739.1 hemolysin expression modulator Hha -
JMW18_RS25920 50315..50572 + 258 WP_004098928.1 hypothetical protein -
JMW18_RS25925 50648..50902 + 255 WP_032425571.1 hypothetical protein -
JMW18_RS25930 51078..51344 + 267 WP_020804426.1 DUF1778 domain-containing protein Antitoxin
JMW18_RS25935 51332..51814 + 483 WP_004098919.1 GNAT family N-acetyltransferase Toxin
JMW18_RS25940 52015..53418 + 1404 WP_001567368.1 ISNCY-like element ISKpn21 family transposase -
JMW18_RS25945 53447..54079 - 633 WP_001567369.1 hypothetical protein -
JMW18_RS25950 54300..55016 + 717 Protein_60 IS3-like element ISKpn38 family transposase -
JMW18_RS25955 55298..56161 - 864 WP_020803592.1 toll/interleukin-1 receptor domain-containing protein -
JMW18_RS25960 56178..56636 - 459 WP_077252872.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..197166 197166
- inside IScluster/Tn - - 45226..55016 9790


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(66-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17335.06 Da        Isoelectric Point: 10.0704

>T290320 WP_004098919.1 NZ_LR890210:51332-51814 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10124.47 Da        Isoelectric Point: 4.3108

>AT290320 WP_020804426.1 NZ_LR890210:51078-51344 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDDSAINELL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J5Q928

Antitoxin

Source ID Structure
AlphaFold DB A0A455TK27

References