Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 18529..19172 | Replicon | plasmid 2 |
| Accession | NZ_LR890210 | ||
| Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | JMW18_RS25755 | Protein ID | WP_001044770.1 |
| Coordinates | 18756..19172 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | JMW18_RS25750 | Protein ID | WP_001261282.1 |
| Coordinates | 18529..18759 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW18_RS25725 | 14562..15557 | + | 996 | WP_049087407.1 | type 3 fimbria adhesin subunit MrkD | - |
| JMW18_RS25730 | 15571..16206 | + | 636 | WP_000677445.1 | type 3 fimbria minor subunit MrkF | - |
| JMW18_RS25735 | 16241..16957 | - | 717 | WP_004149658.1 | phosphodiesterase MrkJ | - |
| JMW18_RS25740 | 17291..18271 | - | 981 | WP_014386491.1 | IS5-like element ISKpn26 family transposase | - |
| JMW18_RS25745 | 18342..18572 | - | 231 | Protein_19 | hypothetical protein | - |
| JMW18_RS25750 | 18529..18759 | + | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMW18_RS25755 | 18756..19172 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW18_RS25760 | 19246..20808 | + | 1563 | WP_009309907.1 | AAA family ATPase | - |
| JMW18_RS25765 | 20793..21815 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| JMW18_RS25770 | 22359..23267 | + | 909 | WP_032425603.1 | HNH endonuclease | - |
| JMW18_RS25775 | 23453..23803 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..197166 | 197166 | |
| - | flank | IS/Tn | - | - | 17291..18271 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T290319 WP_001044770.1 NZ_LR890210:18756-19172 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |