Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 18529..19172 Replicon plasmid 2
Accession NZ_LR890210
Organism Klebsiella pneumoniae isolate INF022-sc-2279895

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag JMW18_RS25755 Protein ID WP_001044770.1
Coordinates 18756..19172 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag JMW18_RS25750 Protein ID WP_001261282.1
Coordinates 18529..18759 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW18_RS25725 14562..15557 + 996 WP_049087407.1 type 3 fimbria adhesin subunit MrkD -
JMW18_RS25730 15571..16206 + 636 WP_000677445.1 type 3 fimbria minor subunit MrkF -
JMW18_RS25735 16241..16957 - 717 WP_004149658.1 phosphodiesterase MrkJ -
JMW18_RS25740 17291..18271 - 981 WP_014386491.1 IS5-like element ISKpn26 family transposase -
JMW18_RS25745 18342..18572 - 231 Protein_19 hypothetical protein -
JMW18_RS25750 18529..18759 + 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW18_RS25755 18756..19172 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW18_RS25760 19246..20808 + 1563 WP_009309907.1 AAA family ATPase -
JMW18_RS25765 20793..21815 + 1023 WP_000361404.1 helicase UvrD -
JMW18_RS25770 22359..23267 + 909 WP_032425603.1 HNH endonuclease -
JMW18_RS25775 23453..23803 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..197166 197166
- flank IS/Tn - - 17291..18271 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T290319 WP_001044770.1 NZ_LR890210:18756-19172 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT290319 WP_001261282.1 NZ_LR890210:18529-18759 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References