Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5184667..5185292 | Replicon | chromosome |
Accession | NZ_LR890209 | ||
Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1F2M041 |
Locus tag | JMW18_RS25265 | Protein ID | WP_008807903.1 |
Coordinates | 5184667..5185050 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMW18_RS25270 | Protein ID | WP_004150355.1 |
Coordinates | 5185050..5185292 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW18_RS25250 | 5182033..5182935 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMW18_RS25255 | 5182932..5183567 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMW18_RS25260 | 5183564..5184493 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMW18_RS25265 | 5184667..5185050 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW18_RS25270 | 5185050..5185292 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMW18_RS25275 | 5185497..5186414 | + | 918 | WP_049155024.1 | alpha/beta hydrolase | - |
JMW18_RS25280 | 5186429..5187370 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
JMW18_RS25285 | 5187415..5187852 | - | 438 | WP_012543288.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW18_RS25290 | 5187849..5188709 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
JMW18_RS25295 | 5188703..5189302 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T290318 WP_008807903.1 NZ_LR890209:c5185050-5184667 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M041 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |