Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mosAT/AbiEii-AbiEi |
Location | 4873257..4874938 | Replicon | chromosome |
Accession | NZ_LR890209 | ||
Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 |
Toxin (Protein)
Gene name | mosT | Uniprot ID | - |
Locus tag | JMW18_RS23815 | Protein ID | WP_022065798.1 |
Coordinates | 4873257..4874174 (-) | Length | 306 a.a. |
Antitoxin (Protein)
Gene name | mosA | Uniprot ID | - |
Locus tag | JMW18_RS23820 | Protein ID | WP_039102729.1 |
Coordinates | 4874180..4874938 (-) | Length | 253 a.a. |
Genomic Context
Location: 4868563..4870083 (1521 bp)
Type: Others
Protein ID: WP_094955305.1
Type: Others
Protein ID: WP_094955305.1
Location: 4870080..4871078 (999 bp)
Type: Others
Protein ID: WP_049162519.1
Type: Others
Protein ID: WP_049162519.1
Location: 4871109..4872050 (942 bp)
Type: Others
Protein ID: WP_012543155.1
Type: Others
Protein ID: WP_012543155.1
Location: 4872125..4873132 (1008 bp)
Type: Others
Protein ID: WP_023339423.1
Type: Others
Protein ID: WP_023339423.1
Location: 4876024..4878171 (2148 bp)
Type: Others
Protein ID: WP_012543160.1
Type: Others
Protein ID: WP_012543160.1
Location: 4878877..4879563 (687 bp)
Type: Others
Protein ID: WP_008807260.1
Type: Others
Protein ID: WP_008807260.1
Location: 4873257..4874174 (918 bp)
Type: Toxin
Protein ID: WP_022065798.1
Type: Toxin
Protein ID: WP_022065798.1
Location: 4874180..4874938 (759 bp)
Type: Antitoxin
Protein ID: WP_039102729.1
Type: Antitoxin
Protein ID: WP_039102729.1
Location: 4875023..4875751 (729 bp)
Type: Others
Protein ID: WP_008807258.1
Type: Others
Protein ID: WP_008807258.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW18_RS23795 | 4868563..4870083 | + | 1521 | WP_094955305.1 | sugar ABC transporter ATP-binding protein | - |
JMW18_RS23800 | 4870080..4871078 | + | 999 | WP_049162519.1 | COG4158 family protein | - |
JMW18_RS23805 | 4871109..4872050 | + | 942 | WP_012543155.1 | ABC transporter substrate-binding protein | - |
JMW18_RS23810 | 4872125..4873132 | + | 1008 | WP_023339423.1 | carbohydrate kinase family protein | - |
JMW18_RS23815 | 4873257..4874174 | - | 918 | WP_022065798.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
JMW18_RS23820 | 4874180..4874938 | - | 759 | WP_039102729.1 | type IV toxin-antitoxin system AbiEi family antitoxin | Antitoxin |
JMW18_RS23825 | 4875023..4875751 | - | 729 | WP_008807258.1 | response regulator transcription factor | - |
JMW18_RS23830 | 4876024..4878171 | + | 2148 | WP_012543160.1 | formate dehydrogenase H subunit alpha, selenocysteine-containing | - |
JMW18_RS23835 | 4878877..4879563 | + | 687 | WP_008807260.1 | sel1 repeat family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 306 a.a. Molecular weight: 34751.14 Da Isoelectric Point: 5.4707
>T290317 WP_022065798.1 NZ_LR890209:c4874174-4873257 [Klebsiella pneumoniae]
MDIQAPYYRQVALLMQVLPYVAVEREFALKGGTAINLFIRDFPRLSVDIDLAWVPLESRTIALPHIRDALARIAANLQQQ
AGMNAVLQANRSDEMRVVVTTDSAQIKIEVSPVARGTLYPPQEREVVGAVEDVFGYASLPVVSLPDLYGGKLCAALDRQH
PRDFYDVKLLLDAQELNRPIFNGFIAYLLSHNRPLAEVLSPRWKDIAEPFYREFSGMTFETIALEELTAVPYRMIDALKS
CFTQQDIDFLLSFKRGEPDWRLAPETRIQDLPAVQWKLRNIHQMPAIKRAESLDKLEKVLAEWRS
MDIQAPYYRQVALLMQVLPYVAVEREFALKGGTAINLFIRDFPRLSVDIDLAWVPLESRTIALPHIRDALARIAANLQQQ
AGMNAVLQANRSDEMRVVVTTDSAQIKIEVSPVARGTLYPPQEREVVGAVEDVFGYASLPVVSLPDLYGGKLCAALDRQH
PRDFYDVKLLLDAQELNRPIFNGFIAYLLSHNRPLAEVLSPRWKDIAEPFYREFSGMTFETIALEELTAVPYRMIDALKS
CFTQQDIDFLLSFKRGEPDWRLAPETRIQDLPAVQWKLRNIHQMPAIKRAESLDKLEKVLAEWRS
Download Length: 918 bp
Antitoxin
Download Length: 253 a.a. Molecular weight: 28642.97 Da Isoelectric Point: 10.1988
>AT290317 WP_039102729.1 NZ_LR890209:c4874938-4874180 [Klebsiella pneumoniae]
MSSKLNWLLQNSAPGDVILQSWLSRHAISPSLAFKYTQSGWLKKRGNGVYARAGREPEWNDALACLQNQLAAPVYVAGLS
SLVWQGRSHYLQLKQNQCWLSMENKALLPKWFREFPGVEWIVISGQKLPVLDDKYRVTLDVKGKRLTGSAPELAAYELLS
AVPGTLSFNHAAELFQGLVNLNPRKVEYLLSVSQSVQTKRLYLFFASFYEHGWLRRIDSQKIDLGAGKRQIVVNGKFNAQ
YQITVPERFQKE
MSSKLNWLLQNSAPGDVILQSWLSRHAISPSLAFKYTQSGWLKKRGNGVYARAGREPEWNDALACLQNQLAAPVYVAGLS
SLVWQGRSHYLQLKQNQCWLSMENKALLPKWFREFPGVEWIVISGQKLPVLDDKYRVTLDVKGKRLTGSAPELAAYELLS
AVPGTLSFNHAAELFQGLVNLNPRKVEYLLSVSQSVQTKRLYLFFASFYEHGWLRRIDSQKIDLGAGKRQIVVNGKFNAQ
YQITVPERFQKE
Download Length: 759 bp