Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3952562..3953181 | Replicon | chromosome |
Accession | NZ_LR890209 | ||
Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | JMW18_RS19370 | Protein ID | WP_002892050.1 |
Coordinates | 3952963..3953181 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
Locus tag | JMW18_RS19365 | Protein ID | WP_008805436.1 |
Coordinates | 3952562..3952936 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW18_RS19355 | 3947717..3948910 | + | 1194 | WP_008805438.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMW18_RS19360 | 3948933..3952079 | + | 3147 | WP_094955339.1 | multidrug efflux RND transporter permease subunit AcrB | - |
JMW18_RS19365 | 3952562..3952936 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
JMW18_RS19370 | 3952963..3953181 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
JMW18_RS19375 | 3953340..3953906 | + | 567 | WP_049156430.1 | maltose O-acetyltransferase | - |
JMW18_RS19380 | 3953878..3954006 | - | 129 | Protein_3799 | hypothetical protein | - |
JMW18_RS19385 | 3954043..3954513 | + | 471 | WP_008805434.1 | YlaC family protein | - |
JMW18_RS19390 | 3954482..3955939 | - | 1458 | WP_008805433.1 | PLP-dependent aminotransferase family protein | - |
JMW18_RS19395 | 3956040..3956738 | + | 699 | WP_016160391.1 | GNAT family N-acetyltransferase | - |
JMW18_RS19400 | 3956735..3956875 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
JMW18_RS19405 | 3956875..3957138 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290316 WP_002892050.1 NZ_LR890209:3952963-3953181 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT290316 WP_008805436.1 NZ_LR890209:3952562-3952936 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2MBN7 |