Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 801378..802035 | Replicon | chromosome |
| Accession | NZ_LR890209 | ||
| Organism | Klebsiella pneumoniae isolate INF022-sc-2279895 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | JMW18_RS03990 | Protein ID | WP_002916310.1 |
| Coordinates | 801625..802035 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | JMW18_RS03985 | Protein ID | WP_002916312.1 |
| Coordinates | 801378..801644 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW18_RS03965 | 797873..798601 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
| JMW18_RS03970 | 798652..798963 | + | 312 | WP_008806430.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMW18_RS03975 | 799126..799785 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| JMW18_RS03980 | 800149..801132 | - | 984 | WP_012967246.1 | tRNA-modifying protein YgfZ | - |
| JMW18_RS03985 | 801378..801644 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| JMW18_RS03990 | 801625..802035 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| JMW18_RS03995 | 802042..802563 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
| JMW18_RS04000 | 802664..803560 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
| JMW18_RS04005 | 803583..804296 | + | 714 | WP_008806425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMW18_RS04010 | 804302..806035 | + | 1734 | WP_049156820.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T290310 WP_002916310.1 NZ_LR890209:801625-802035 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |