Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 334734..335320 Replicon chromosome
Accession NZ_LR890209
Organism Klebsiella pneumoniae isolate INF022-sc-2279895

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag JMW18_RS01580 Protein ID WP_094955330.1
Coordinates 334952..335320 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW18_RS01575 Protein ID WP_004174006.1
Coordinates 334734..334955 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW18_RS01555 330891..331817 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW18_RS01560 331814..333091 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
JMW18_RS01565 333088..333855 + 768 WP_012967117.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW18_RS01570 333857..334570 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW18_RS01575 334734..334955 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW18_RS01580 334952..335320 + 369 WP_094955330.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW18_RS01585 335612..336928 + 1317 WP_008806974.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW18_RS01590 337035..337922 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW18_RS01595 337919..338764 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW18_RS01600 338766..339836 + 1071 WP_023323353.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 331814..340573 8759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13538.90 Da        Isoelectric Point: 8.6410

>T290308 WP_094955330.1 NZ_LR890209:334952-335320 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMSVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT290308 WP_004174006.1 NZ_LR890209:334734-334955 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References