Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 63398..63999 Replicon plasmid 3
Accession NZ_LR890206
Organism Klebsiella pneumoniae isolate INF277

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag JMW21_RS26900 Protein ID WP_001216047.1
Coordinates 63398..63778 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JMW21_RS26905 Protein ID WP_001190712.1
Coordinates 63778..63999 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW21_RS26875 58838..60322 - 1485 WP_000124159.1 hypothetical protein -
JMW21_RS26880 60322..61515 - 1194 WP_000219604.1 terminase -
JMW21_RS26885 61602..62054 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
JMW21_RS26890 62143..63186 - 1044 WP_023351456.1 DUF968 domain-containing protein -
JMW21_RS26895 63214..63393 - 180 WP_000113019.1 hypothetical protein -
JMW21_RS26900 63398..63778 - 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW21_RS26905 63778..63999 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW21_RS26910 64072..64461 - 390 WP_000506726.1 DNA repair protein -
JMW21_RS26915 64585..64836 - 252 WP_001283837.1 DNA polymerase III subunit theta -
JMW21_RS26920 65010..65219 + 210 WP_001344848.1 hypothetical protein -
JMW21_RS26925 65204..65488 - 285 WP_001142394.1 hypothetical protein -
JMW21_RS26930 65472..66152 - 681 WP_023351458.1 hypothetical protein -
JMW21_RS26935 66134..66508 - 375 WP_000988652.1 hypothetical protein -
JMW21_RS26940 66515..66808 - 294 WP_000267998.1 hypothetical protein -
JMW21_RS26945 66832..67113 - 282 WP_000002126.1 ASCH domain-containing protein -
JMW21_RS26950 67113..67373 - 261 WP_000969524.1 hypothetical protein -
JMW21_RS26955 67370..67909 - 540 WP_023351701.1 DUF551 domain-containing protein -
JMW21_RS26960 67906..68421 - 516 WP_001229210.1 hypothetical protein -
JMW21_RS26965 68423..68611 - 189 WP_000797279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95815 95815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T290306 WP_001216047.1 NZ_LR890206:c63778-63398 [Klebsiella pneumoniae]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT290306 WP_001190712.1 NZ_LR890206:c63999-63778 [Klebsiella pneumoniae]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References