Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5152119..5152744 | Replicon | chromosome |
| Accession | NZ_LR890204 | ||
| Organism | Klebsiella pneumoniae isolate INF277 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JMW21_RS24875 | Protein ID | WP_021312635.1 |
| Coordinates | 5152119..5152502 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | JMW21_RS24880 | Protein ID | WP_004150355.1 |
| Coordinates | 5152502..5152744 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW21_RS24860 | 5149485..5150387 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| JMW21_RS24865 | 5150384..5151019 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMW21_RS24870 | 5151016..5151945 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| JMW21_RS24875 | 5152119..5152502 | - | 384 | WP_021312635.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW21_RS24880 | 5152502..5152744 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMW21_RS24885 | 5152949..5153866 | + | 918 | WP_004178029.1 | alpha/beta hydrolase | - |
| JMW21_RS24890 | 5153880..5154821 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| JMW21_RS24895 | 5154866..5155303 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMW21_RS24900 | 5155300..5156160 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| JMW21_RS24905 | 5156154..5156753 | - | 600 | WP_040148118.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14349.56 Da Isoelectric Point: 7.3178
>T290304 WP_021312635.1 NZ_LR890204:c5152502-5152119 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVATPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVATPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|