Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4675543..4676059 | Replicon | chromosome |
Accession | NZ_LR890204 | ||
Organism | Klebsiella pneumoniae isolate INF277 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | JMW21_RS22585 | Protein ID | WP_002886902.1 |
Coordinates | 4675543..4675827 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMW21_RS22590 | Protein ID | WP_002886901.1 |
Coordinates | 4675817..4676059 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW21_RS22560 | 4670960..4671268 | - | 309 | WP_004178377.1 | PTS sugar transporter subunit IIB | - |
JMW21_RS22565 | 4671353..4671526 | + | 174 | WP_004222159.1 | hypothetical protein | - |
JMW21_RS22570 | 4671529..4672272 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMW21_RS22575 | 4672629..4674767 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMW21_RS22580 | 4675075..4675539 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMW21_RS22585 | 4675543..4675827 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW21_RS22590 | 4675817..4676059 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMW21_RS22595 | 4676137..4678047 | - | 1911 | WP_040147048.1 | BglG family transcription antiterminator | - |
JMW21_RS22600 | 4678070..4679224 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
JMW21_RS22605 | 4679291..4680031 | - | 741 | WP_040147051.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T290302 WP_002886902.1 NZ_LR890204:c4675827-4675543 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |