Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3353776..3354292 | Replicon | chromosome |
Accession | NZ_LR890202 | ||
Organism | Klebsiella pneumoniae isolate INF008-sc-2279879 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | JMV80_RS16195 | Protein ID | WP_004178374.1 |
Coordinates | 3353776..3354060 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMV80_RS16200 | Protein ID | WP_002886901.1 |
Coordinates | 3354050..3354292 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV80_RS16170 | 3349166..3349474 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
JMV80_RS16175 | 3349559..3349732 | + | 174 | WP_032431440.1 | hypothetical protein | - |
JMV80_RS16180 | 3349735..3350478 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMV80_RS16185 | 3350835..3352973 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMV80_RS16190 | 3353308..3353772 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMV80_RS16195 | 3353776..3354060 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV80_RS16200 | 3354050..3354292 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMV80_RS16205 | 3354370..3356280 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMV80_RS16210 | 3356303..3357457 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
JMV80_RS16215 | 3357524..3358264 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T290284 WP_004178374.1 NZ_LR890202:c3354060-3353776 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |