Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 123342..124078 | Replicon | chromosome |
| Accession | NZ_LR890202 | ||
| Organism | Klebsiella pneumoniae isolate INF008-sc-2279879 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | JMV80_RS00655 | Protein ID | WP_032433360.1 |
| Coordinates | 123596..124078 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMV80_RS00650 | Protein ID | WP_003026799.1 |
| Coordinates | 123342..123608 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV80_RS00625 | 118988..120127 | + | 1140 | WP_040025615.1 | mannitol dehydrogenase | - |
| JMV80_RS00630 | 120156..120818 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit L | - |
| JMV80_RS00635 | 120802..121806 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| JMV80_RS00640 | 121824..122456 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| JMV80_RS00645 | 122466..123029 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| JMV80_RS00650 | 123342..123608 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMV80_RS00655 | 123596..124078 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| JMV80_RS00660 | 124439..125038 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| JMV80_RS00665 | 125251..126195 | - | 945 | WP_077266259.1 | fimbrial protein | - |
| JMV80_RS00670 | 126207..126785 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| JMV80_RS00675 | 126789..127529 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T290275 WP_032433360.1 NZ_LR890202:123596-124078 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |