Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 106651..107294 | Replicon | chromosome |
Accession | NZ_LR890202 | ||
Organism | Klebsiella pneumoniae isolate INF008-sc-2279879 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | JMV80_RS00560 | Protein ID | WP_032433387.1 |
Coordinates | 106878..107294 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | JMV80_RS00555 | Protein ID | WP_001261276.1 |
Coordinates | 106651..106881 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV80_RS00540 | 101673..102760 | + | 1088 | Protein_101 | transcriptional regulator | - |
JMV80_RS00545 | 102763..105003 | + | 2241 | WP_045326788.1 | NTPase | - |
JMV80_RS00550 | 105531..106346 | - | 816 | WP_032433388.1 | hypothetical protein | - |
JMV80_RS00555 | 106651..106881 | + | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMV80_RS00560 | 106878..107294 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMV80_RS00565 | 107450..108430 | + | 981 | WP_032433385.1 | hypothetical protein | - |
JMV80_RS00570 | 108625..110196 | - | 1572 | WP_032433383.1 | ATP-binding protein | - |
JMV80_RS00575 | 110515..110763 | + | 249 | WP_032433382.1 | hypothetical protein | - |
JMV80_RS00580 | 110822..111340 | + | 519 | WP_045326794.1 | hypothetical protein | - |
JMV80_RS00585 | 111371..111862 | + | 492 | WP_040154632.1 | hypothetical protein | - |
JMV80_RS00590 | 111922..112125 | + | 204 | WP_032433376.1 | hemolysin expression modulator Hha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T290274 WP_032433387.1 NZ_LR890202:106878-107294 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |