Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 103448..104091 Replicon plasmid 2
Accession NZ_LR890199
Organism Escherichia coli isolate MINF_1D-sc-2280456

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag JMV89_RS24870 Protein ID WP_001034044.1
Coordinates 103675..104091 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag JMV89_RS24865 Protein ID WP_001261286.1
Coordinates 103448..103678 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV89_RS24850 98585..98815 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMV89_RS24855 98812..99228 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
JMV89_RS24860 99273..103067 - 3795 WP_001144732.1 hypothetical protein -
JMV89_RS24865 103448..103678 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMV89_RS24870 103675..104091 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
JMV89_RS24875 104166..105731 + 1566 WP_001128474.1 AAA family ATPase -
JMV89_RS24880 105716..106738 + 1023 WP_000361402.1 helicase UvrD -
JMV89_RS24885 106992..107689 - 698 Protein_129 IS1 family transposase -
JMV89_RS24890 108045..108959 + 915 WP_000949004.1 iron/manganese ABC transporter substrate-binding protein SitA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / blaCTX-M-15 / sitABCD iucA / iucB / iucC / iucD / iutA 1..125802 125802
- flank IS/Tn sitABCD - 106992..111494 4502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T290271 WP_001034044.1 NZ_LR890199:103675-104091 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT290271 WP_001261286.1 NZ_LR890199:103448-103678 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References